Houd mijn sessie geopend
Eindigt in 
De sessie is verlopen
Uw sessie is verlopen. Voor uw veiligheid bent u uitgelogd.
Wilt u opnieuw inloggen?

Anti-SOD2 Rabbit Polyclonal Antibody

Leverancier: US Biological
Type: Primary
Antigen: SOD2 (superoxide dismutase 2, mitochondrial)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

Order

Expand All / Collapse All
Maat VPE VWR catalogus nummer Hoeveelheid
100 µg 100 µG USBI133696
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

Specificaties

Antigen symbol SOD2
Antigen name Superoxide Dismutase 2
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Rabbit
Isotype IgG
Western blot Yes
Purification purified by Protein A chromatography
Sequentie MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Form liquid
Opslagbuffer PBS, pH 7,2.
Opslagtemperatuur Cool
Shipping temperature Ice

WRITE A REVIEW

Need help?

  • Whatever you have to say, positive or negative, is important to us.
  • Providing feedback takes only seconds.
  • Your feedback will be made available to the public on the web.

VWR.com will publish your name as vwr.com user.
You can use this name, or edit and save a nickname.
We recommend authors use their first and last initial.

Please confirm the industry you work in

Example: Pharmaceutical

Please confirm your role

Example: Clinical Trial Assistant

Please confirm your location

Example: New York, NY

REVIEWS (0)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

Sort all by:

Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'X' if unknown for VWR Chemicals. Enter a space if unknown for Merck Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Of
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Omschrijving Catalogus nummer Availability Unit Uw prijs Price Per Hoeveelheid
 

Een nieuwe uitstraling en een hernieuwde belofte

Gebouwd op de kenmerken & middelen die u kent, geoptimaliseerd met de innovatie van Avantor ®. Ons nieuwe merk symboliseert flexibiliteit en ons vermogen om ons aan de behoeften van de klant aan te passen.

KOM MEER TE WETEN BEGIN MET WINKELEN