Houd mijn sessie geopend
Eindigt in 
De sessie is verlopen
Uw sessie is verlopen. Voor uw veiligheid bent u uitgelogd.
Wilt u opnieuw inloggen?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Leverancier: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

Order

Expand All / Collapse All
Maat VPE VWR catalogus nummer Hoeveelheid
100 µg 100 µG USBI133736
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

Specificaties

Antigen symbol SP3
Antigen name Sp3 transcription factor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3H7
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 516 to 616
Purification purified by Protein A chromatography
Sequentie GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Form liquid
Opslagbuffer PBS, pH 7,2.
Opslagtemperatuur Cool
Shipping temperature Ice

WRITE A REVIEW

Need help?

  • Whatever you have to say, positive or negative, is important to us.
  • Providing feedback takes only seconds.
  • Your feedback will be made available to the public on the web.

VWR.com will publish your name as vwr.com user.
You can use this name, or edit and save a nickname.
We recommend authors use their first and last initial.

Please confirm the industry you work in

Example: Pharmaceutical

Please confirm your role

Example: Clinical Trial Assistant

Please confirm your location

Example: New York, NY

REVIEWS (0)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

Sort all by:

Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'X' if unknown for VWR Chemicals. Enter a space if unknown for Merck Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Of
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Omschrijving Catalogus nummer Availability Unit Uw prijs Price Per Hoeveelheid
 

Een nieuwe uitstraling en een hernieuwde belofte

Gebouwd op de kenmerken & middelen die u kent, geoptimaliseerd met de innovatie van Avantor ®. Ons nieuwe merk symboliseert flexibiliteit en ons vermogen om ons aan de behoeften van de klant aan te passen.

KOM MEER TE WETEN BEGIN MET WINKELEN